PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_110607g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HB-other
Protein Properties Length: 162aa    MW: 19147.3 Da    PI: 7.9388
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_110607g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-213186156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ +++t++q++eLe +F+++++p+ ++r+eL+++l+L+ rq+k+WFqN+R+++k
  MA_110607g0010 31 KKRYHRHTQHQIQELEMFFRECPHPDDKQRQELSRRLSLEPRQIKFWFQNKRTQMK 86
                    688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-201987IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-221989IPR009057Homeodomain-like
PROSITE profilePS5007117.3132888IPR001356Homeobox domain
SMARTSM003891.8E-182992IPR001356Homeobox domain
PfamPF000461.0E-183186IPR001356Homeobox domain
CDDcd000861.97E-163189No hitNo description
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MREEEFESKS GSENIEGASG EDQDADPRSR KKRYHRHTQH QIQELEMFFR ECPHPDDKQR  60
QELSRRLSLE PRQIKFWFQN KRTQMKAHHE RQDNLMLKSE NEKLRLDNMR YRDALSSISC  120
PNCGGPATLG EISFDEQQLR RPHFGHCCKI RGEASAIFSN TS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931820.12e-75PREDICTED: homeobox-leucine zipper protein ROC2
RefseqXP_010931821.12e-75PREDICTED: homeobox-leucine zipper protein ROC2
SwissprotQ0J9X25e-72ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLQ9FR599e-75Q9FR59_PICAB; Homeobox 1
STRINGGSMUA_Achr11P25820_0019e-72(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.42e-68homeodomain GLABROUS 2